Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gasket, Oil Filter - CRF/CBR/CBF
Gasket, Oil Filter - CRF/CBR/CBF
Gasket, Oil Filter - CRF/CBR/CBF
Gasket, Oil Filter - CRF/CBR/CBF

Gasket, Oil Filter - CRF/CBR/CBF

Product Code: 15412-KYJ-901
Brand: Honda
Product Condition: New
weight: 5.0g
Bulk Buying Options
single: £3.75
2 up to 5: £3.25 per item
£3.75 inc. tax
 Add to Cart
Description
Genuine Honda Oil filter gasket to fit :
  • CRF250L & Rally (2013-20)
  • CRF300L & Rally (2021-23)
  • CBR250R (2011-13)
  • CBR300R (2015-22)
  • CB300F (2015-18)
  • CBF300 (2019-23)
Honda recomends a new gasket is used each time the filter cover is removed. The gasket has a "crush" sealing area that is only good for a one time use.
Honda main dealer price for comparision: 15412-KYJ-901
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i