Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Brake Caliper Piston Seal Kit - CRF250/300
Brake Caliper Piston Seal Kit - CRF250/300
Brake Caliper Piston Seal Kit - CRF250/300
Brake Caliper Piston Seal Kit - CRF250/300
Brake Caliper Piston Seal Kit - CRF250/300
Notify me when product is back in stock

Brake Caliper Piston Seal Kit - CRF250/300

Product Code: 06431-MA3-405
Brand: Honda
Product Condition: New
weight: 10.0g
£7.00 inc. tax
 Add to Cart
Description
Genuine Honda Brake Caliper Piston replacement rubber seals.  This packet of 2 seals, will rebuild just one piston, so on the CRF, two sets are required for the front caliper, and just one for the rear.
Please order accordingly.
These fit many Honda models including:
  • CRF250 L & Rally (All years)
  • CRF300 L & Rally (All years)
  • CBR300 R (All years)
Honda main dealer price for comparison: 06431-MA3-405
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i