Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Cam chain tensioner - CRF250/300
Cam chain tensioner - CRF250/300
Cam chain tensioner - CRF250/300
Cam chain tensioner - CRF250/300
Cam chain tensioner - CRF250/300
Cam chain tensioner - CRF250/300

Cam chain tensioner - CRF250/300

Product Code: 14520-K33-D01
Brand: Honda
Product Condition: New
weight: 85.0g
£30.00 inc. tax
 Add to Cart
Description
Genuine Honda Cam chain tensioner & gasket to fit :
  • CRF250 L & Rally (2017-20)
  • CRF300 L & Rally (2021-23)
  • CBR250 R (2015)
  • CBR300 R (2016-19)
  • CBF300 (2018-19)
Please note this part now has a black plastic body, as compared to the original design that was made in Aluminium.

Honda main dealer price for comparison: 14520-K33-D01
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i