Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Clutch Lever Perch & Clamp - CRF250/300
Clutch Lever Perch & Clamp - CRF250/300
Clutch Lever Perch & Clamp - CRF250/300
Clutch Lever Perch & Clamp - CRF250/300
Notify me when product is back in stock

Clutch Lever Perch & Clamp - CRF250/300

Product Code: 53172-KZZ-900
Brand: Honda
Product Condition: New
weight: 100.0g
£23.00 inc. tax
 Add to Cart
Description

Genuine Honda Clutch Lever Pivot/Perch & Clamp to fit:

  • CRF250L & Rally (2013-20)
  • CRF300L & Rally (2021-23)

Please note the pivot bolts are not included.
Honda main dealer price for comparison: 53172-KZZ-900 / 53174-KZZ-900

Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i