Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Drive V-Belt – NSC110 Vision (2017-20)
Drive V-Belt – NSC110 Vision (2017-20)
Drive V-Belt – NSC110 Vision (2017-20)
Drive V-Belt – NSC110 Vision (2017-20)

Drive V-Belt – NSC110 Vision (2017-20)

Product Code: 23100-K44-V01
Brand: Honda
Product Condition: New
weight: 250.0g
£25.00 inc. tax
 Add to Cart
Description
Genuine Honda Variator Drive Belt.

These fit the Honda:
  • NSC110MPD-H Vision (2017)
  • NSC110MPD-K Vision (2019-20)
Rollers & Slides are available as an optional extra.

Honda main dealer price for comparison:
Belt : 23100-K44-V01
Rollers : 22123-K44-V00
Slides : 22011-KVB-T00
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i