Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Drive V-Belt - PCX125 C/D & ANC125 (2012-14)
Drive V-Belt - PCX125 C/D & ANC125 (2012-14)
Drive V-Belt - PCX125 C/D & ANC125 (2012-14)
Drive V-Belt - PCX125 C/D & ANC125 (2012-14)
Notify me when product is back in stock

Drive V-Belt - PCX125 C/D & ANC125 (2012-14)

Product Code: 23100-KZR-601
Brand: Honda
Product Condition: New
weight: 250.0g
£26.00 inc. tax
 Add to Cart
Description
Genuine Honda Variator Drive V-Belt.  

These fit the Honda:
  • PCX125 WW125 EX2 C (2012)
  • PCX125 WW125 D (2013-14)
  • ANC125 E (2014)
Rollers & Slides are available as an optional extra for the PCX belt only.

Honda main dealer price for comparison:
Belt : 23100-KZR-601
Rollers : 22123-KWN-900
Slides : 22011-KWN-900
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i