Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gasket, Engine, Right - CRF/CBR/CBF
Gasket, Engine, Right - CRF/CBR/CBF
Gasket, Engine, Right - CRF/CBR/CBF

Gasket, Engine, Right - CRF/CBR/CBF

Product Code: 11394-K87-A30
Brand: Honda
Product Condition: New
weight: 20.0g
£9.00 inc. tax
 Add to Cart
Description
Genuine Honda Engine Crankcase Cover Gasket, RIGHT (Brake pedal / Water pump side) - to fit:
  • CRF250L & Rally (all years)
  • CRF300L & Rally (all years)
  • CB300R (2018 on)
  • CBR250R (2018 on)
  • CBF300 (2018 on)
This replaces 11394-KYJ-900 & 901
Honda main dealer prices for comparison: 11394K87A30
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i