Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gear change pedal/lever - CRF250/300
Gear change pedal/lever - CRF250/300
Gear change pedal/lever - CRF250/300
Gear change pedal/lever - CRF250/300
Gear change pedal/lever - CRF250/300
Gear change pedal/lever - CRF250/300
Notify me when product is back in stock

Gear change pedal/lever - CRF250/300

Product Code: 24700-K1T-E10
Brand: Honda
Product Condition: New
weight: 162.0g
£19.00 inc. tax
 Add to Cart
Description
Genuine Honda Gear change lever/pedal to fit :
  • CRF250 L & Rally (2013-20)
  • CRF300 L & Rally (2021-23)
24700-KZZ-J00 (as specified for the 250) is identical and will be supplied until stocks are exhausted.
Honda main dealer price for comparison: 24700-KZZ-J00 and 24700-K1T-E10
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i