Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Gear selector spindle shaft - CRF/CBR/CBF 250/300
Gear selector spindle shaft - CRF/CBR/CBF 250/300
Gear selector spindle shaft - CRF/CBR/CBF 250/300
Gear selector spindle shaft - CRF/CBR/CBF 250/300

Gear selector spindle shaft - CRF/CBR/CBF 250/300

Product Code: 24610-KYJ-900
Brand: Honda
Product Condition: New
weight: 250.0g
£30.00 inc. tax
 Add to Cart
Description
Genuine Honda Gear selector spindle shaft to fit :
  • CRF250 L & Rally (2013-20)
  • CRF300 L & Rally (2021-23)
  • CBR250 (2011-13)
  • CBR300 R (2015-23)
  • CB300F (2015-18)
  • CBF300 (2019-23)
The shaft is supplied complete with a new spring & circlip.

Honda main dealer price for comparison: 24610-KYJ-900
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i