Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Indicator lens RF/LR - CRF/MSX/CTX
Indicator lens RF/LR - CRF/MSX/CTX
Indicator lens RF/LR - CRF/MSX/CTX

Indicator lens RF/LR - CRF/MSX/CTX

Product Code: 33404-MGS-J32
Brand: Honda
Product Condition: New
weight: 41.0g
£9.00 inc. tax
 Add to Cart
Description

Genuine Honda Indicator / Turn Signal Lens (aka., winker, flasher, etc.)
This fits the RIGHT FRONT, or the LEFT REAR indicator, as sat on the bike, on the following models:

  • CRF250 L & M (2013-20)
  • CRF300 L (2021-24)
  • MSX125 Grom (2013-24)
  • CMX500 Rebel
  • CTX700 (2014-16)

The listing is just for one lens only - it does not include any bulbs, screws, or gaskets.

Honda main dealer price for comparison : 33404-MGS-J32

Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i