Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125
Speedo Gauge Upper Cover - CRF250 / MSX125

Speedo Gauge Upper Cover - CRF250 / MSX125

Product Code: 37610-K26-901
Brand: Honda
Product Condition: New
weight: 100.0g
£25.00 inc. tax
 Add to Cart
Description
Genuine Honda Speedo Gauge Plastic "glass" cover, to fit:
  • CRF250 L & Rally (2017-20)
  • MSX125SF GROM (2015-20)
Honda main dealer price for comparison:  37610-K26-901
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i