Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Spoke, REAR wheel - CRF250/300

Spoke, REAR wheel - CRF250/300

Product Code: 06420-KZZ-900
Brand: Honda
Product Condition: New
weight: 20.0g
Bulk Buying Options
single: £2.00
2 up to 9: £1.80 per item
10 up to 31: £1.65 per item
32 up to 50: £1.50 per item
£2.00 inc. tax
 Add to Cart
Description
Genuine Honda REAR wheel spoke to fit :
  • CRF250 L & Rally (2013-20)
  • CRF300 L & Rally (2021-23)
Purchase options are
  1. Single spoke - £2.00
  2. 2-9 - £1.80 each
  3. 10-31 - £1.65 each
  4. Full wheel set of 32 - £1.50 each (£48/set)
Honda main dealer price (single spoke) for comparison: 06420-KZZ-900
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i