Welcome to Hereford Honda Parts
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Wheel Bearing Set, Front - CRF250 Mk2/300
Wheel Bearing Set, Front - CRF250 Mk2/300
Wheel Bearing Set, Front - CRF250 Mk2/300
Wheel Bearing Set, Front - CRF250 Mk2/300

Wheel Bearing Set, Front - CRF250 Mk2/300

Product Code: 91051-KZZ-J00
Brand: Honda
Product Condition: New
weight: 150.0g
£30.00 inc. tax
 Add to Cart
Description
Genuine Honda FRONT wheel bearing & seal kit, to fit:
  • CRF250 L & Rally (2017-20)
  • CRF300 L & Rally (2021-23)
This will not fit the early model 2013-16 CRF250L.

Honda main dealer price (totals £86.56) for comparison:
Seal 91253-KZR-601 or 91253-K35-V01
Bearing 91051-KZZ-J00
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i